Archive/Therapeutic Effect of Alpha-Pinene on In Vitro and In Vivo Models of Mild Traumatic Brain Injury
Therapeutic Effect of Alpha-Pinene on In Vitro and In Vivo Models of Mild Traumatic Brain Injury
Harry Jung, Tae Yeon Kim, Dong Hyuk Youn et al.
2. Juli 2026
en

Abstract

We aimed to investigate the therapeutic effects of alpha-pinene (α-pinene), a major component of phytoncide, in in vitro and in vivo models of mild traumatic brain injury (mTBI), raising the possibility of treating mTBI, a condition currently lacking adequate therapies. An in vitro model was established using SH-SY5Y cells and a cell injury controller, and was treated with α-pinene (0.5 g/mL). An in vivo model was induced by a stereotaxic impactor in male C57BL/6J mice and treated with α-pinene intravenously (50 mg/kg and 100 mg/kg) for 3 days post-injury. Histopathological and immunohistochemical comparisons were conducted alongside cognitive function tests to evaluate -pinene treatment. In vitro analysis showed that alpha-pinene treatment significantly increased TUNEL-positive cells. Elevated NOX4 and p22phox mRNA expressions and a high Bax/Bcl-2 protein expression ratio were noted following alpha-pinene treatment. mTBI mice treated with alpha-pinene exhibited a notable decrease in brain water content with fewer FJB-positive neurons and lower protein expression of Bax and Bcl-2 compared to untreated mTBI mice. Immunofluorescence staining for NOX4 and GFAP-positive or Iba-1-positive cells demonstrated that the increased oxidative stress and astrogliosis or activated microglia triggered by mTBI were alleviated after alpha-pinene treatment. Cognitive function testing revealed a general improvement in mTBI mice treated with alpha-pinene, with statistical significance observed in the NOR test. Alpha-pinene appears to be beneficial for neuroprotection and enhancing cognitive function in the early phases of mTBI.

IPC Classification

C07

Keywords

therapeuticeffectalpha-pinenevitrovivomodelsmildtraumaticbraininjurylifeaimedinvestigateeffects-pinenemajorcomponentphytoncidemtbiraisingpossibilitytreatingconditioncurrently
Diese Veröffentlichung zitieren

€ 4.00